(data stored in ACNUC7421 zone)

EMBL: CP001791.PE163

CP001791.PE163       Location/Qualifiers
FT   CDS             178930..179853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0167"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: pen:PSEEN2341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97715"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU2"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ADH97715.1"
FT                   /translation="MPDRLIVLNKDEDTLSIVNADTGMTEKTVATSHNPHELVVSRDGL
FT                   KTYIACSLGNTVDILDNRTFEIVRHLTHPDFDFPHGLGLTNDGKKLYLASTFSEKVFII
FT                   DTKTDEIESVTKTGQKLSHMISFSPDGNTVYIPNIGSHNLTVMDTDTETITTHIPVGKG
FT                   PEGVAVHPDGRHLYVANQEEDTLHILDTESHEVLYKRRVGHVPVRLVFSPDGKYALIAN
FT                   RESNDVSIIDTAQHINGETRPWEIKRLPVGVWAGGIVFSPDGQKAYVANNKTNDVSVID
FT                   MTTLKEERRFDVGIHPDGIAYLEKRT"
     MPDRLIVLNK DEDTLSIVNA DTGMTEKTVA TSHNPHELVV SRDGLKTYIA CSLGNTVDIL        60
     DNRTFEIVRH LTHPDFDFPH GLGLTNDGKK LYLASTFSEK VFIIDTKTDE IESVTKTGQK       120
     LSHMISFSPD GNTVYIPNIG SHNLTVMDTD TETITTHIPV GKGPEGVAVH PDGRHLYVAN       180
     QEEDTLHILD TESHEVLYKR RVGHVPVRLV FSPDGKYALI ANRESNDVSI IDTAQHINGE       240
     TRPWEIKRLP VGVWAGGIVF SPDGQKAYVA NNKTNDVSVI DMTTLKEERR FDVGIHPDGI       300
     AYLEKRT                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page