(data stored in ACNUC7421 zone)

EMBL: CP001791.PE164

CP001791.PE164       Location/Qualifiers
FT   CDS             complement(179915..180856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0168"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: csa:Csal_3169
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97716"
FT                   /db_xref="GOA:D6XVU3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU3"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADH97716.1"
FT                   /translation="MRTWKKSLGAFSAVAVAASLTACGNNAEDNNDNINADGANDADAA
FT                   NNADGNEAIGNGEEITISQISWAENIAVTNMWKYVLEEKGYEIDLVLLDMGSSMAALDN
FT                   GELDVNLEVWLPVQDANYVEQYGDTVNFSEATWFDNAKVGLVVPEYLEDVNSIEDLNEH
FT                   ADLFNGEIVGIEAGAGTMEVTEDLIEIYDLDLELVPSSEPAMLSEIGNRIEAGEAIVAP
FT                   LWTPHWVFSEYDLKFLEDPELVYGDVEKIHHATRADFADDFPEIQEWFNNWKMTDEEIG
FT                   ELIDYVESADEPFDGAVEWVDENRDLIDEWVQ"
     MRTWKKSLGA FSAVAVAASL TACGNNAEDN NDNINADGAN DADAANNADG NEAIGNGEEI        60
     TISQISWAEN IAVTNMWKYV LEEKGYEIDL VLLDMGSSMA ALDNGELDVN LEVWLPVQDA       120
     NYVEQYGDTV NFSEATWFDN AKVGLVVPEY LEDVNSIEDL NEHADLFNGE IVGIEAGAGT       180
     MEVTEDLIEI YDLDLELVPS SEPAMLSEIG NRIEAGEAIV APLWTPHWVF SEYDLKFLED       240
     PELVYGDVEK IHHATRADFA DDFPEIQEWF NNWKMTDEEI GELIDYVESA DEPFDGAVEW       300
     VDENRDLIDE WVQ                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page