(data stored in ACNUC7421 zone)

EMBL: CP001791.PE167

CP001791.PE167       Location/Qualifiers
FT   CDS             complement(183382..183837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0171"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pat:Patl_0928 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97719"
FT                   /db_xref="GOA:D6XVU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH97719.1"
FT                   /translation="MTREIRPVDASNWRAIIALKPKAHQESFIEPNAVSILESFYDRSL
FT                   KWSCYGLYEDGKPVGFMMAGAGSLYERYIWLDRFMLDGAYQGDGRGKAFLALIIRFLSA
FT                   KWYVKTIKTSMKADNEAVKHLYTSAGFVSTGTIDPEFDEEVWVYQVT"
     MTREIRPVDA SNWRAIIALK PKAHQESFIE PNAVSILESF YDRSLKWSCY GLYEDGKPVG        60
     FMMAGAGSLY ERYIWLDRFM LDGAYQGDGR GKAFLALIIR FLSAKWYVKT IKTSMKADNE       120
     AVKHLYTSAG FVSTGTIDPE FDEEVWVYQV T                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page