(data stored in ACNUC7421 zone)

EMBL: CP001791.PE17

CP001791.PE17        Location/Qualifiers
FT   CDS             26876..28666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0018"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: pca:Pcar_1870 dipeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97569"
FT                   /db_xref="GOA:D6XV11"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV11"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADH97569.1"
FT                   /translation="MKRSKFLLPAALLSTTMVVAACGGNNDDGNENNTDPANDGNNDNA
FT                   EMNDDNDDNDETADGDVPQGGTVTYGYTSPFAGLLDWAWYEGQDDSLALSLFNGEALYQ
FT                   VRSENEFELEPSLAREWEWSDDNTTVTFHLEEGVMWHDGVELTAEDFKFSYETIAHPDG
FT                   NTARQSNVDRIVGYDEYRAGETDELAGVEVIDDYTFSVEFKEVQANNLANLWSYPMSVN
FT                   HLGHLEVSEMEDADEIRRNPVGLGAFVVDNVVPGEMIEYSAFEDYWQGAPNLDGVVYRI
FT                   VDGELSGELLAQGEVDVIELTGGQALPLQDDDRVYLEEIEALSYMYIGFKLGHWDDEEG
FT                   TAVMDNEKFQSKELRHAFAHAIDRQGIIDSFMEGYGTVINAPESVIRWSYPDESALNQY
FT                   EHDPDRARELLEEAGYEDVTGDGFVEDPNGDEFTVNFAAMNAPADIAEPRAQYIIQNLQ
FT                   DVGINAQLMDGQLLDFNLFYDLVEEDDSDIDIFMGAWGLATADPDLSGLWLSTDFWNFT
FT                   RWVNEESDELIRAGVSEEALDFEYRQSVYQEWHQLFNEELPMIPISSPVNIYGIAADVG
FT                   GITAEVRDAAGDAHLWYREQ"
     MKRSKFLLPA ALLSTTMVVA ACGGNNDDGN ENNTDPANDG NNDNAEMNDD NDDNDETADG        60
     DVPQGGTVTY GYTSPFAGLL DWAWYEGQDD SLALSLFNGE ALYQVRSENE FELEPSLARE       120
     WEWSDDNTTV TFHLEEGVMW HDGVELTAED FKFSYETIAH PDGNTARQSN VDRIVGYDEY       180
     RAGETDELAG VEVIDDYTFS VEFKEVQANN LANLWSYPMS VNHLGHLEVS EMEDADEIRR       240
     NPVGLGAFVV DNVVPGEMIE YSAFEDYWQG APNLDGVVYR IVDGELSGEL LAQGEVDVIE       300
     LTGGQALPLQ DDDRVYLEEI EALSYMYIGF KLGHWDDEEG TAVMDNEKFQ SKELRHAFAH       360
     AIDRQGIIDS FMEGYGTVIN APESVIRWSY PDESALNQYE HDPDRARELL EEAGYEDVTG       420
     DGFVEDPNGD EFTVNFAAMN APADIAEPRA QYIIQNLQDV GINAQLMDGQ LLDFNLFYDL       480
     VEEDDSDIDI FMGAWGLATA DPDLSGLWLS TDFWNFTRWV NEESDELIRA GVSEEALDFE       540
     YRQSVYQEWH QLFNEELPMI PISSPVNIYG IAADVGGITA EVRDAAGDAH LWYREQ           596
//

If you have problems or comments...

PBIL Back to PBIL home page