(data stored in ACNUC7421 zone)

EMBL: CP001791.PE170

CP001791.PE170       Location/Qualifiers
FT   CDS             186442..187095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0174"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="KEGG: mxa:MXAN_0609 PAP2 family protein; PFAM:
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97722"
FT                   /db_xref="GOA:D6XVU9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU9"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADH97722.1"
FT                   /translation="MHTNHWLTRQPLFLSTGVAFFILSMLSIVGLFDAIDLAVMDWVYH
FT                   SAPAFLTNAMTVITEFGSVELIAVMSILVLGLLLYQRRIRDMILFVAVSGGGLAVNLGL
FT                   KFLFQRERPGELNMIDAFGIELAIPSYSYPSGHTMRAAILVLLIIYLLGTWVKRREQTR
FT                   LVTTAGLLLLTLVAASRVLTGAHFPTDAVGAVLASVAFVSLCVRLYEQRWRKPS"
     MHTNHWLTRQ PLFLSTGVAF FILSMLSIVG LFDAIDLAVM DWVYHSAPAF LTNAMTVITE        60
     FGSVELIAVM SILVLGLLLY QRRIRDMILF VAVSGGGLAV NLGLKFLFQR ERPGELNMID       120
     AFGIELAIPS YSYPSGHTMR AAILVLLIIY LLGTWVKRRE QTRLVTTAGL LLLTLVAASR       180
     VLTGAHFPTD AVGAVLASVA FVSLCVRLYE QRWRKPS                                217
//

If you have problems or comments...

PBIL Back to PBIL home page