(data stored in ACNUC7421 zone)

EMBL: CP001791.PE171

CP001791.PE171       Location/Qualifiers
FT   CDS             complement(187166..188023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0175"
FT                   /product="Glucan endo-1,3-beta-D-glucosidase"
FT                   /EC_number="3.2.1.39"
FT                   /note="KEGG: hch:HCH_04792 beta-glucanase/beta-glucan
FT                   synthetase; PFAM: glycoside hydrolase family 16"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97723"
FT                   /db_xref="GOA:D6XVV0"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV0"
FT                   /inference="protein motif:PRIAM:3.2.1.39"
FT                   /protein_id="ADH97723.1"
FT                   /translation="MNKLIIMAGLSLVTLAACGNGENEAENAGIDAPEGWNLVWHDEFD
FT                   GESLDEDKWRYDIGNGFYDGDEWVEGWGNEELQSYQEDNVTLRDGSLVIEAREETVSDD
FT                   YGTFDYTSGKILTEGLFSQTHGRFEASISLPEGQGFWPAFWMMPEDDAYGNWAASGEID
FT                   IMENRGSETDIVGAAIHYGGVFPDNTYTADEYVFDDGETTTDYNVYAVEWEPGEIRWYV
FT                   NDDEYAVMNQWYSENGEFPAPFDEDFHLILNLAVGGWYGGDPDDTTPFPAEMKVDYVRV
FT                   YEQE"
     MNKLIIMAGL SLVTLAACGN GENEAENAGI DAPEGWNLVW HDEFDGESLD EDKWRYDIGN        60
     GFYDGDEWVE GWGNEELQSY QEDNVTLRDG SLVIEAREET VSDDYGTFDY TSGKILTEGL       120
     FSQTHGRFEA SISLPEGQGF WPAFWMMPED DAYGNWAASG EIDIMENRGS ETDIVGAAIH       180
     YGGVFPDNTY TADEYVFDDG ETTTDYNVYA VEWEPGEIRW YVNDDEYAVM NQWYSENGEF       240
     PAPFDEDFHL ILNLAVGGWY GGDPDDTTPF PAEMKVDYVR VYEQE                       285
//

If you have problems or comments...

PBIL Back to PBIL home page