(data stored in ACNUC7421 zone)

EMBL: CP001791.PE176

CP001791.PE176       Location/Qualifiers
FT   CDS             191722..192474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0180"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: mxa:MXAN_6161 GntR family transcriptional
FT                   regulator; PFAM: UbiC transcription regulator-associated
FT                   domain protein; regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97728"
FT                   /db_xref="GOA:D6XVV5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV5"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADH97728.1"
FT                   /translation="MDHLSKEQSLHQTVKEQLITDIQSKKYPVHAQLPTEAELCKTFDV
FT                   SRTTIRNALQQLVNEGYIERVQGKGTFVRQQRIKQTLTSTEGSYVEQLKLQGKHPEVKV
FT                   VDLTVIPTDERLSLALEIAEGEPLNKLERIRYADNQPLQYETAYLPWRLTTGLRKESCE
FT                   GSLYSVLRDELELPIAKTEEHLHITRADQTVAGYLGIAEGDPCIQIETYAYLDDGTKIE
FT                   YSIACFHGDKVSFTVERHYGQTSEPGSP"
     MDHLSKEQSL HQTVKEQLIT DIQSKKYPVH AQLPTEAELC KTFDVSRTTI RNALQQLVNE        60
     GYIERVQGKG TFVRQQRIKQ TLTSTEGSYV EQLKLQGKHP EVKVVDLTVI PTDERLSLAL       120
     EIAEGEPLNK LERIRYADNQ PLQYETAYLP WRLTTGLRKE SCEGSLYSVL RDELELPIAK       180
     TEEHLHITRA DQTVAGYLGI AEGDPCIQIE TYAYLDDGTK IEYSIACFHG DKVSFTVERH       240
     YGQTSEPGSP                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page