(data stored in ACNUC7421 zone)

EMBL: CP001791.PE177

CP001791.PE177       Location/Qualifiers
FT   CDS             complement(192555..193262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0181"
FT                   /product="YdjC family protein"
FT                   /note="PFAM: YdjC family protein; KEGG: pmr:PMI2951
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97729"
FT                   /db_xref="GOA:D6XVV6"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV6"
FT                   /inference="protein motif:PFAM:PF04794"
FT                   /protein_id="ADH97729.1"
FT                   /translation="MKFIVNADDFGLSRAVNYGIFDAMTNGVVSSATLMVNMPGTLHAA
FT                   ELIHENKLSNIGVHLVLTSGRPMTNATSLTNENGDFRLSNRFASELDNGPKLDLDEVEA
FT                   EWSAQIERFFDIAGHPHHFDSHHHIHMYEPLAPVVRHLAEKYSLPVRAGNRIGVSSVSD
FT                   DFHDGFYQDAVSIDFFRKLYEQHKHKSGTIEIMSHPAYIDRTLQAYSSYQNERLAEFDV
FT                   LTSHALKESGWFA"
     MKFIVNADDF GLSRAVNYGI FDAMTNGVVS SATLMVNMPG TLHAAELIHE NKLSNIGVHL        60
     VLTSGRPMTN ATSLTNENGD FRLSNRFASE LDNGPKLDLD EVEAEWSAQI ERFFDIAGHP       120
     HHFDSHHHIH MYEPLAPVVR HLAEKYSLPV RAGNRIGVSS VSDDFHDGFY QDAVSIDFFR       180
     KLYEQHKHKS GTIEIMSHPA YIDRTLQAYS SYQNERLAEF DVLTSHALKE SGWFA            235
//

If you have problems or comments...

PBIL Back to PBIL home page