(data stored in ACNUC7421 zone)

EMBL: CP001791.PE179

CP001791.PE179       Location/Qualifiers
FT   CDS             194756..196063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0183"
FT                   /product="PTS system, cellobiose-specific IIC subunit"
FT                   /note="TIGRFAM: PTS system, cellobiose-specific IIC
FT                   subunit; PTS system, lactose/cellobiose family IIC subunit;
FT                   KEGG: hsm:HSM_0456 PTS system lactose/cellobiose family IIC
FT                   subunit; PFAM: phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97731"
FT                   /db_xref="GOA:D6XVV8"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV8"
FT                   /inference="protein motif:TFAM:TIGR00359"
FT                   /protein_id="ADH97731.1"
FT                   /translation="MNAIMNWMEKHFIPVASRIGAQRHLVAVRDGFVAIMPLIILGSFA
FT                   VLINNLPIDVFQNFMLSLFGEGWKAVGGNIWDGSFAILTLLVVAGISYNLAKSYDVDGM
FT                   SAVLIGLASFIILTPTTEDWGLAYAWTGAQGLFVGVITALVTTELFRVLYRSKFTIKMP
FT                   DGVPDGVVKSFRALIPAAIILIFIALVQIFITSLTDGSLHELIFTLIQEPLQALGNTLP
FT                   AAIIIAFLNHLLWFFGLHGTNILGPVIESIYLPLIEVNIQQFASGVSAHDVPYIITKPF
FT                   LDAYVFMGGSGTTLALIFAIFLVAKTKHYRTIGKIAAPAGGFNINEPILFGLPVVLNPV
FT                   MLIPFIFIPVLLTVTSYVALVTGVVPKTVAMVPWTTPPIISGYLVTGGSITGIILQLFN
FT                   LTLATLLYIPFIRASERAEERKQEILKQEMKGDKQS"
     MNAIMNWMEK HFIPVASRIG AQRHLVAVRD GFVAIMPLII LGSFAVLINN LPIDVFQNFM        60
     LSLFGEGWKA VGGNIWDGSF AILTLLVVAG ISYNLAKSYD VDGMSAVLIG LASFIILTPT       120
     TEDWGLAYAW TGAQGLFVGV ITALVTTELF RVLYRSKFTI KMPDGVPDGV VKSFRALIPA       180
     AIILIFIALV QIFITSLTDG SLHELIFTLI QEPLQALGNT LPAAIIIAFL NHLLWFFGLH       240
     GTNILGPVIE SIYLPLIEVN IQQFASGVSA HDVPYIITKP FLDAYVFMGG SGTTLALIFA       300
     IFLVAKTKHY RTIGKIAAPA GGFNINEPIL FGLPVVLNPV MLIPFIFIPV LLTVTSYVAL       360
     VTGVVPKTVA MVPWTTPPII SGYLVTGGSI TGIILQLFNL TLATLLYIPF IRASERAEER       420
     KQEILKQEMK GDKQS                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page