(data stored in ACNUC7421 zone)

EMBL: CP001791.PE18

CP001791.PE18        Location/Qualifiers
FT   CDS             28773..29738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0019"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oan:Oant_3319
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97570"
FT                   /db_xref="GOA:D6XV12"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV12"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97570.1"
FT                   /translation="MLIYTMRRILVMIPIMIMISVVVFVLALMMPGDALSGQIDPSNSN
FT                   PEYIAEMREELGLNDPAHVQYGRWISGVVQWDFGRSVVHRMGVMDLIGERLPNTIRLSV
FT                   LSLIITYILAFFMGRYAGRNPYTPGDYTIQGVNYLMLAIPSFVASIFAIFIFSFQLGWF
FT                   PATGSIGSGMTPGTFEYWMSRLHHVALPALVLGMLTTASYTQFLRNDIIESSQKDYVRT
FT                   ARAKGTPENEIYNKHILRNSIIPIVTLFGFDIASIIGGSVIIETIFSYRGIGELLITSI
FT                   QQRDSAVVVAVTLMLSIATLIGNLIADLVYGVVDPRIRVE"
     MLIYTMRRIL VMIPIMIMIS VVVFVLALMM PGDALSGQID PSNSNPEYIA EMREELGLND        60
     PAHVQYGRWI SGVVQWDFGR SVVHRMGVMD LIGERLPNTI RLSVLSLIIT YILAFFMGRY       120
     AGRNPYTPGD YTIQGVNYLM LAIPSFVASI FAIFIFSFQL GWFPATGSIG SGMTPGTFEY       180
     WMSRLHHVAL PALVLGMLTT ASYTQFLRND IIESSQKDYV RTARAKGTPE NEIYNKHILR       240
     NSIIPIVTLF GFDIASIIGG SVIIETIFSY RGIGELLITS IQQRDSAVVV AVTLMLSIAT       300
     LIGNLIADLV YGVVDPRIRV E                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page