(data stored in ACNUC7421 zone)

EMBL: CP001791.PE181

CP001791.PE181       Location/Qualifiers
FT   CDS             196401..196712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0185"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG: yen:YE1294
FT                   putative exported PTS system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97733"
FT                   /db_xref="GOA:D6XVW0"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW0"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ADH97733.1"
FT                   /translation="MKIILVCSAGMSTSMLVKKMRQAAEAKGIDAEVDATAEAGLHNEF
FT                   DSTDVILIGPQVRYLEKKIAEKSAPYKIPVAVIDSMAYGMMDGNKVLDQALDLQKTHR"
     MKIILVCSAG MSTSMLVKKM RQAAEAKGID AEVDATAEAG LHNEFDSTDV ILIGPQVRYL        60
     EKKIAEKSAP YKIPVAVIDS MAYGMMDGNK VLDQALDLQK THR                         103
//

If you have problems or comments...

PBIL Back to PBIL home page