(data stored in ACNUC7421 zone)

EMBL: CP001791.PE182

CP001791.PE182       Location/Qualifiers
FT   CDS             197598..198509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0187"
FT                   /product="ATPase BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   oan:Oant_3124 ATPase BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97734"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW1"
FT                   /inference="protein motif:PFAM:PF01869"
FT                   /protein_id="ADH97734.1"
FT                   /translation="MFVLGIDGGGSSTVARLADYAGNSIKTVQVGEINSTMMNKDDWIQ
FT                   SCSSILNHFESYVDRIQCIFIGLSGISRLKIETIEFLKEDLKKRIHPDAEVFIVNDAVL
FT                   GLYAGTGGEDGIVNIAGTGSQTFGLKNGVEFKIGGWGHKFDHTGSGYGIAIEGIKSVIT
FT                   AYENRSPFNYFEKAVMDAWGEDSFMEMMEKINSGSSAKQIAQLSKTICALATEDEQARR
FT                   IIDRAAHDISDAITRMSEAHFAGEKGVKVILMGGLMNQQDLFLPLLEKKLPHALLKVLD
FT                   QEPVEGAVIAGLKAVKGSENGD"
     MFVLGIDGGG SSTVARLADY AGNSIKTVQV GEINSTMMNK DDWIQSCSSI LNHFESYVDR        60
     IQCIFIGLSG ISRLKIETIE FLKEDLKKRI HPDAEVFIVN DAVLGLYAGT GGEDGIVNIA       120
     GTGSQTFGLK NGVEFKIGGW GHKFDHTGSG YGIAIEGIKS VITAYENRSP FNYFEKAVMD       180
     AWGEDSFMEM MEKINSGSSA KQIAQLSKTI CALATEDEQA RRIIDRAAHD ISDAITRMSE       240
     AHFAGEKGVK VILMGGLMNQ QDLFLPLLEK KLPHALLKVL DQEPVEGAVI AGLKAVKGSE       300
     NGD                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page