(data stored in ACNUC7421 zone)

EMBL: CP001791.PE183

CP001791.PE183       Location/Qualifiers
FT   CDS             198499..199647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mxa:MXAN_4187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97735"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW2"
FT                   /inference="protein motif:PFAM:PF07075"
FT                   /protein_id="ADH97735.1"
FT                   /translation="MVIKTGLDNLLETNIPDLKKRSVGLVINHTSIDQRKQLSLDILYR
FT                   EGCQIKAVFTPEHGFRGTADAGEHVKDDYDGKTGIPIYSLYGKQKRPAKHMLEGLDALV
FT                   FDIQDLGVRFYTYIYTLAYCMEEAAKYGLEVWVLDRPNPINGQFVEGNRVRDNFTSFIG
FT                   NYRLPVRHGMTVGELAAYFKETFKIDVDLKVVKMIGWTREMHFTDTGLHWVNPSPSATG
FT                   ETMALCYPGTCFMEGLNVSEGRGTDYPFEQIGAPWLDGEAVCNRIKNKSMPGVNLHPVS
FT                   FTPINADYMQIACGGIFLEVTDRYQFSALETSLALVDVIHEMYPGNLKVKDPIKGRFFF
FT                   DLLFGTDEARKKMNHSESLLEWMRENDESSAFKLERKPFLMY"
     MVIKTGLDNL LETNIPDLKK RSVGLVINHT SIDQRKQLSL DILYREGCQI KAVFTPEHGF        60
     RGTADAGEHV KDDYDGKTGI PIYSLYGKQK RPAKHMLEGL DALVFDIQDL GVRFYTYIYT       120
     LAYCMEEAAK YGLEVWVLDR PNPINGQFVE GNRVRDNFTS FIGNYRLPVR HGMTVGELAA       180
     YFKETFKIDV DLKVVKMIGW TREMHFTDTG LHWVNPSPSA TGETMALCYP GTCFMEGLNV       240
     SEGRGTDYPF EQIGAPWLDG EAVCNRIKNK SMPGVNLHPV SFTPINADYM QIACGGIFLE       300
     VTDRYQFSAL ETSLALVDVI HEMYPGNLKV KDPIKGRFFF DLLFGTDEAR KKMNHSESLL       360
     EWMRENDESS AFKLERKPFL MY                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page