(data stored in ACNUC7421 zone)

EMBL: CP001791.PE184

CP001791.PE184       Location/Qualifiers
FT   CDS             199676..200608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0189"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hypothetical protein; K01207 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97736"
FT                   /db_xref="GOA:D6XVW3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH97736.1"
FT                   /translation="MHLWEDVKQQYSDQICILWNRIYGDRFPLRKSLFQQNSIEDIHVD
FT                   ADASRLVTVGDEAVGLIIVKRDHYNRFQRSQAWIHLLMVDPTYQHRGIGSKLLKQAEAT
FT                   VVNMGASEIVIGQDPYHYFPGVPADQNAIKKWLMKRGYTNVNSVSDYVNTSPQSERKLD
FT                   TENILSSDEKGKLFSFLKAYFSSRWLYEAEEYFLKGGSGSAYVIIKDQGEIIAFCKTNI
FT                   GEKPLIGSNVNWSQRFTGILGGIGPLGVHPEWRKMKLGREIVLLATRHLLNQGVGSIYI
FT                   DWTELHGFYRSLGYTSIETYDQFKKTIEI"
     MHLWEDVKQQ YSDQICILWN RIYGDRFPLR KSLFQQNSIE DIHVDADASR LVTVGDEAVG        60
     LIIVKRDHYN RFQRSQAWIH LLMVDPTYQH RGIGSKLLKQ AEATVVNMGA SEIVIGQDPY       120
     HYFPGVPADQ NAIKKWLMKR GYTNVNSVSD YVNTSPQSER KLDTENILSS DEKGKLFSFL       180
     KAYFSSRWLY EAEEYFLKGG SGSAYVIIKD QGEIIAFCKT NIGEKPLIGS NVNWSQRFTG       240
     ILGGIGPLGV HPEWRKMKLG REIVLLATRH LLNQGVGSIY IDWTELHGFY RSLGYTSIET       300
     YDQFKKTIEI                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page