(data stored in ACNUC7421 zone)

EMBL: CP001791.PE185

CP001791.PE185       Location/Qualifiers
FT   CDS             200665..201573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0190"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="KEGG: plu:plu0403 N-acetylmuramic acid-6-phosphate
FT                   etherase; TIGRFAM: glucokinase regulatory-like protein;
FT                   PFAM: sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97737"
FT                   /db_xref="GOA:D6XVW4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW4"
FT                   /inference="protein motif:TFAM:TIGR00274"
FT                   /protein_id="ADH97737.1"
FT                   /translation="MTINLSDLTTERRNERTKHIDQLSSFEILSMINEEDHLIAESVKK
FT                   EMKAINNVVEVVCERFKKGGKLVYIGAGTSGRIGVLDAAEAPPTFRTDPEMIQALIAGG
FT                   DQAMFHAIEGAEDSKEQAKQDLERLNLSKDDVIIAIAASGRTPYAKGAVEYGNEINAVT
FT                   VGLSCNKGSELSALAQLAIEVEVGPEVITGSTRMKAATAQKLVLNMISTSSMILIGKIF
FT                   ENLMVDLKASNHKLQERAKSITSAITGCSEEEVEQTLIKADFEVKPAIVMLKTGVSLVE
FT                   AKEKLKQHRGFVRKAIESQSK"
     MTINLSDLTT ERRNERTKHI DQLSSFEILS MINEEDHLIA ESVKKEMKAI NNVVEVVCER        60
     FKKGGKLVYI GAGTSGRIGV LDAAEAPPTF RTDPEMIQAL IAGGDQAMFH AIEGAEDSKE       120
     QAKQDLERLN LSKDDVIIAI AASGRTPYAK GAVEYGNEIN AVTVGLSCNK GSELSALAQL       180
     AIEVEVGPEV ITGSTRMKAA TAQKLVLNMI STSSMILIGK IFENLMVDLK ASNHKLQERA       240
     KSITSAITGC SEEEVEQTLI KADFEVKPAI VMLKTGVSLV EAKEKLKQHR GFVRKAIESQ       300
     SK                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page