(data stored in ACNUC7421 zone)

EMBL: CP001791.PE188

CP001791.PE188       Location/Qualifiers
FT   CDS             203962..204924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0193"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xop:PXO_00882 L-arabinose
FT                   transport system permease protein AraQ"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97740"
FT                   /db_xref="GOA:D6XVW7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97740.1"
FT                   /translation="MFQRRIKKPIIIVSLLIMALISLLPLYWVFVTALQLPSYQNEEMD
FT                   RPVSYVESSPPVLYPVGITEYVSQWQKKREAESQGDMEQAEVHSSLMTEVREKTFGSFT
FT                   HLFENTKIMRWLFNSVYIAVVTTAIIVLIDTMAGYVLAKKDFPGKWIIFWMIISTMMIP
FT                   EQVTLVPTFIIVQNLNMFDTHFALIFPMLALAFGVFLMRQFLLSIPDELIEAAKIDGAS
FT                   EWKIFRSIIVPLARPAMAVLGIFTFVLVWNSFLWPIIVINDENLMTLPAGLKTLQDANL
FT                   ADFKLLMTGATVAAVPMIIFFLMFQRYFIKGLTIGGVKE"
     MFQRRIKKPI IIVSLLIMAL ISLLPLYWVF VTALQLPSYQ NEEMDRPVSY VESSPPVLYP        60
     VGITEYVSQW QKKREAESQG DMEQAEVHSS LMTEVREKTF GSFTHLFENT KIMRWLFNSV       120
     YIAVVTTAII VLIDTMAGYV LAKKDFPGKW IIFWMIISTM MIPEQVTLVP TFIIVQNLNM       180
     FDTHFALIFP MLALAFGVFL MRQFLLSIPD ELIEAAKIDG ASEWKIFRSI IVPLARPAMA       240
     VLGIFTFVLV WNSFLWPIIV INDENLMTLP AGLKTLQDAN LADFKLLMTG ATVAAVPMII       300
     FFLMFQRYFI KGLTIGGVKE                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page