(data stored in ACNUC7421 zone)

EMBL: CP001791.PE19

CP001791.PE19        Location/Qualifiers
FT   CDS             29753..30655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0020"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sat:SYN_01342 oligopeptide
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97571"
FT                   /db_xref="GOA:D6XV13"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV13"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97571.1"
FT                   /translation="MATIDKAKEKELEKRAKKQSPWSIARKKFFNNKLAMISLVFLVVV
FT                   TTLAILSYWIAPFDPSRVDPTNRFTEPGGDHLLGTDGAGRDVWTLLLYGARTSLLIGFT
FT                   ATIGIVIIATVIGSVSGYYGGIVDAVLMRFTDFMMNFPFLVFVIVLASIFRDSGVFALI
FT                   LVLMVLSWTGAARVVRSKTMSEKENEYVLAAISIGGTPFKVIRKHMLPNVMTTIIVQAT
FT                   LLLAVMIVAETALSFLGFGVPQGTPSWGNMMSEASNPNVIRNYWWIWMPPGLAITFTIL
FT                   SINFIGEGIKDAFNPKSLR"
     MATIDKAKEK ELEKRAKKQS PWSIARKKFF NNKLAMISLV FLVVVTTLAI LSYWIAPFDP        60
     SRVDPTNRFT EPGGDHLLGT DGAGRDVWTL LLYGARTSLL IGFTATIGIV IIATVIGSVS       120
     GYYGGIVDAV LMRFTDFMMN FPFLVFVIVL ASIFRDSGVF ALILVLMVLS WTGAARVVRS       180
     KTMSEKENEY VLAAISIGGT PFKVIRKHML PNVMTTIIVQ ATLLLAVMIV AETALSFLGF       240
     GVPQGTPSWG NMMSEASNPN VIRNYWWIWM PPGLAITFTI LSINFIGEGI KDAFNPKSLR       300
//

If you have problems or comments...

PBIL Back to PBIL home page