(data stored in ACNUC7421 zone)

EMBL: CP001791.PE196

CP001791.PE196       Location/Qualifiers
FT   CDS             213054..214289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0201"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: shn:Shewana3_4163 restriction
FT                   modification system DNA specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97748"
FT                   /db_xref="GOA:D6XVX5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX5"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADH97748.1"
FT                   /translation="MTNKLVPEIRFDSFKDKWLTRNLNEIMKFSNGINAPKEAYGQGRK
FT                   MISVLDILSEEYLTYDNVRNSVSVSEILEQKNKVEFGDLVFVRSSEVLNEVGLSKAYLD
FT                   NEYALYSGFSIRGKKISEYDPIFVERSLNGISRRQIERKSGGSTRYNVSQEILNSLFIN
FT                   MPTVQEQQKIGEFFKNLDDRIALQQQHITLLKESKQGFLQKMFPKDGERVPEVRFDGFS
FT                   GEWEVLEIKNIAAETYGGGTPKTSISDYWNGNIPWIQSSDLKTDVLNLVSPTKFISDAG
FT                   INNSATKLVPENSIAIVTRVGVGKLALVPYPYATSQDFLSLSSLKIDLKFALYSLYLII
FT                   KKEVNNLQGTSIKGITKPELLKKKIIIPSNLKEQQKIGEFFKNLDDSIAAHEKELELLQ
FT                   ETKKGFLQKMFV"
     MTNKLVPEIR FDSFKDKWLT RNLNEIMKFS NGINAPKEAY GQGRKMISVL DILSEEYLTY        60
     DNVRNSVSVS EILEQKNKVE FGDLVFVRSS EVLNEVGLSK AYLDNEYALY SGFSIRGKKI       120
     SEYDPIFVER SLNGISRRQI ERKSGGSTRY NVSQEILNSL FINMPTVQEQ QKIGEFFKNL       180
     DDRIALQQQH ITLLKESKQG FLQKMFPKDG ERVPEVRFDG FSGEWEVLEI KNIAAETYGG       240
     GTPKTSISDY WNGNIPWIQS SDLKTDVLNL VSPTKFISDA GINNSATKLV PENSIAIVTR       300
     VGVGKLALVP YPYATSQDFL SLSSLKIDLK FALYSLYLII KKEVNNLQGT SIKGITKPEL       360
     LKKKIIIPSN LKEQQKIGEF FKNLDDSIAA HEKELELLQE TKKGFLQKMF V                411
//

If you have problems or comments...

PBIL Back to PBIL home page