(data stored in ACNUC7421 zone)

EMBL: CP001791.PE198

CP001791.PE198       Location/Qualifiers
FT   CDS             217545..218399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97750"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97750.1"
FT                   /translation="MNIEPIYKEYRRLKKSIDSQEAICLRDWNKSISVIYEKGKYKVDV
FT                   DLYTLDITNRKDITNGLYAKYEHKLKGYNFDNAKQDITNSSRRDERRIWSGYLKLKYPD
FT                   SYLDIKFIDRERPDYYLYVNGCVIAVEVVEAMFQKQGKFRNWHRSFLGKNKMISDLVNH
FT                   RYYDDSFYLEEDNNMIWSSCHKGMINSSAIRIKIIDAILSKVKKYKNYMKDVELPKEKC
FT                   ILVGYTSIGLIDESDFLDLGRRIAQEEQIRSSHIERIIVTSYLYNNLVEYDRCGEIVHY
FT                   KIT"
     MNIEPIYKEY RRLKKSIDSQ EAICLRDWNK SISVIYEKGK YKVDVDLYTL DITNRKDITN        60
     GLYAKYEHKL KGYNFDNAKQ DITNSSRRDE RRIWSGYLKL KYPDSYLDIK FIDRERPDYY       120
     LYVNGCVIAV EVVEAMFQKQ GKFRNWHRSF LGKNKMISDL VNHRYYDDSF YLEEDNNMIW       180
     SSCHKGMINS SAIRIKIIDA ILSKVKKYKN YMKDVELPKE KCILVGYTSI GLIDESDFLD       240
     LGRRIAQEEQ IRSSHIERII VTSYLYNNLV EYDRCGEIVH YKIT                        284
//

If you have problems or comments...

PBIL Back to PBIL home page