(data stored in ACNUC7421 zone)

EMBL: CP001791.PE2

CP001791.PE2         Location/Qualifiers
FT   CDS             2218..3360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: glo:Glov_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97554"
FT                   /db_xref="GOA:D6XUZ6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D6XUZ6"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADH97554.1"
FT                   /translation="MKFTIQRDAFVQSVADVSKAISPRTTIQILTGIKIVADQDGITLT
FT                   GSDSDLSIESFIPKEKDGEELVNIQEEGSIVLQARFFGDMIKKLPETSIEVAVNDQFIA
FT                   QITSGGSVFNINGIDPDEYPRLPDVEEADLFRMPKNLLKTLIRQTAFAVSSVETRPILT
FT                   GIHWHLEDSVLTCTATDSHRLAMRMAKVDDNENNLSFSNVVIPGKTLTELNKILNDTDE
FT                   LLEVVVAGNQILFKGDYFLLYSRLLEGNYPATKNMIPTGSKTSVKLETKRLLDAIERAL
FT                   LLSREGKNNVVHVKNLESGELEITSVTPEVGKVTEHVTTMSYEGDELKISFNGKNLIDA
FT                   LRVMEASEVHINFTGAMSPFVLKPIDEDHMLHLFSPVRTY"
     MKFTIQRDAF VQSVADVSKA ISPRTTIQIL TGIKIVADQD GITLTGSDSD LSIESFIPKE        60
     KDGEELVNIQ EEGSIVLQAR FFGDMIKKLP ETSIEVAVND QFIAQITSGG SVFNINGIDP       120
     DEYPRLPDVE EADLFRMPKN LLKTLIRQTA FAVSSVETRP ILTGIHWHLE DSVLTCTATD       180
     SHRLAMRMAK VDDNENNLSF SNVVIPGKTL TELNKILNDT DELLEVVVAG NQILFKGDYF       240
     LLYSRLLEGN YPATKNMIPT GSKTSVKLET KRLLDAIERA LLLSREGKNN VVHVKNLESG       300
     ELEITSVTPE VGKVTEHVTT MSYEGDELKI SFNGKNLIDA LRVMEASEVH INFTGAMSPF       360
     VLKPIDEDHM LHLFSPVRTY                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page