(data stored in ACNUC7421 zone)

EMBL: CP001791.PE201

CP001791.PE201       Location/Qualifiers
FT   CDS             220905..221189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0206"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bph:Bphy_3633 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97753"
FT                   /db_xref="GOA:D6XU44"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D6XU44"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADH97753.1"
FT                   /translation="MTTRKRRSFTKEFKEQIVQLHQAGKPRSELIKEYELTPSAFDKWV
FT                   RQYQGSGSFKEKDNRTSVEEELLQLKKENKQLTMENDILKQAALIIGRK"
     MTTRKRRSFT KEFKEQIVQL HQAGKPRSEL IKEYELTPSA FDKWVRQYQG SGSFKEKDNR        60
     TSVEEELLQL KKENKQLTME NDILKQAALI IGRK                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page