(data stored in ACNUC7421 zone)

EMBL: CP001791.PE202

CP001791.PE202       Location/Qualifiers
FT   CDS             221231..222019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0207"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   net:Neut_2192 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97754"
FT                   /db_xref="GOA:D6XU45"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D6XU45"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADH97754.1"
FT                   /translation="MCDVLQIARSSFYYESKRQNESEQEELTELIVSIFMKSRKIYGQR
FT                   KIKAELKRAGWTVSRRRIKRIMAEQGLVSKYTVAQFKPSKSSCNESETGNTLDRKFDQD
FT                   DELSVVVSDLTYVRVNKAWHYICVLVDLYNREIIGFSAGPHKTAELVQTAFASVPYNLN
FT                   RIEIFHTDRGTEFKNHLIDQALDTFGITRSLSDKGTPYDNAVAEATFKTIKIEFVRGAV
FT                   FSSQQELDLELFDYVNWFNNIRIHGSLDYLSPAEYKSTGP"
     MCDVLQIARS SFYYESKRQN ESEQEELTEL IVSIFMKSRK IYGQRKIKAE LKRAGWTVSR        60
     RRIKRIMAEQ GLVSKYTVAQ FKPSKSSCNE SETGNTLDRK FDQDDELSVV VSDLTYVRVN       120
     KAWHYICVLV DLYNREIIGF SAGPHKTAEL VQTAFASVPY NLNRIEIFHT DRGTEFKNHL       180
     IDQALDTFGI TRSLSDKGTP YDNAVAEATF KTIKIEFVRG AVFSSQQELD LELFDYVNWF       240
     NNIRIHGSLD YLSPAEYKST GP                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page