(data stored in ACNUC7421 zone)

EMBL: CP001791.PE204

CP001791.PE204       Location/Qualifiers
FT   CDS             224746..227007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppg:PputGB1_4757 protein of unknown function
FT                   DUF900 hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97756"
FT                   /db_xref="GOA:D6XVY3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97756.1"
FT                   /translation="MNHSREIYQEVIRKVEKVISTLESEGTDSEIIEYQNQARNKLSAL
FT                   YQTLVDNLQSLEKNSEWNVFTIAFYGETNAGKSTLIETLRILLKEKTKLQERMTFDKAL
FT                   HDYKQVQFKINDLNTIIKSLENSYENELMIKQDILNGLLLRKTDLESSLEILESRLNEL
FT                   HYDILHKIVFRSFDFIRSMFNKLDEQTEIDNIVLEINDVGEKMKSLEEEIIKRQDDLDE
FT                   TDEKYDSDKKSRMKEAALLQNTIAELEQILTNNSDAKIVGDGRSDFTRNVTEYRFAFNN
FT                   QTFVISDLPGIEGNEKSVQAEIDGAIEKAHAVFYISGKANPPQKGNDERTGTIAKIKNH
FT                   LEKHSEVYFIYNKRVNNPRQLSKTLITDSESESLNVVDRVMAETLGKQYNHHLSLSGYP
FT                   ALVSIGNYWGGRLEKSKYKFLDTFDSPKVIMTYSGVKTFSDWMTTNLVENINFKIEKAN
FT                   VNKVSFSLNDTINNLGELSDSFNRLEHKLKSTLKGSSDQLEEVEELFYRNVINSMNGAI
FT                   NKFKQSLRKKMYSDIDQDINNDQFSNRLKQRTEEEVERLIKDFEKRIHKNVEDFEGHMS
FT                   AVIEKNQQYVEELLESYSNSVEFTFEFDPEIKMKKSVNPAEVAASAGGLIYGVIFNVMN
FT                   LTNPFGWALLAISVITLIVFASKTIYKVLNSDYRKSQQKKSTDENIQEIANKLRASLEE
FT                   EVDKTVTPVNNAVNRIVKDIETSVSQVEVMRQVFEDVESELRVMARDIEYREELINGNN
FT                   "
     MNHSREIYQE VIRKVEKVIS TLESEGTDSE IIEYQNQARN KLSALYQTLV DNLQSLEKNS        60
     EWNVFTIAFY GETNAGKSTL IETLRILLKE KTKLQERMTF DKALHDYKQV QFKINDLNTI       120
     IKSLENSYEN ELMIKQDILN GLLLRKTDLE SSLEILESRL NELHYDILHK IVFRSFDFIR       180
     SMFNKLDEQT EIDNIVLEIN DVGEKMKSLE EEIIKRQDDL DETDEKYDSD KKSRMKEAAL       240
     LQNTIAELEQ ILTNNSDAKI VGDGRSDFTR NVTEYRFAFN NQTFVISDLP GIEGNEKSVQ       300
     AEIDGAIEKA HAVFYISGKA NPPQKGNDER TGTIAKIKNH LEKHSEVYFI YNKRVNNPRQ       360
     LSKTLITDSE SESLNVVDRV MAETLGKQYN HHLSLSGYPA LVSIGNYWGG RLEKSKYKFL       420
     DTFDSPKVIM TYSGVKTFSD WMTTNLVENI NFKIEKANVN KVSFSLNDTI NNLGELSDSF       480
     NRLEHKLKST LKGSSDQLEE VEELFYRNVI NSMNGAINKF KQSLRKKMYS DIDQDINNDQ       540
     FSNRLKQRTE EEVERLIKDF EKRIHKNVED FEGHMSAVIE KNQQYVEELL ESYSNSVEFT       600
     FEFDPEIKMK KSVNPAEVAA SAGGLIYGVI FNVMNLTNPF GWALLAISVI TLIVFASKTI       660
     YKVLNSDYRK SQQKKSTDEN IQEIANKLRA SLEEEVDKTV TPVNNAVNRI VKDIETSVSQ       720
     VEVMRQVFED VESELRVMAR DIEYREELIN GNN                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page