(data stored in ACNUC7421 zone)

EMBL: CP001791.PE205

CP001791.PE205       Location/Qualifiers
FT   CDS             226994..228664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0211"
FT                   /product="labile enterotoxin output A"
FT                   /note="KEGG: ppg:PputGB1_4758 labile enterotoxin output A"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97757"
FT                   /db_xref="GOA:D6XVY4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040576"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY4"
FT                   /inference="similar to AA sequence:KEGG:PputGB1_4758"
FT                   /protein_id="ADH97757.1"
FT                   /translation="METIDYFKQRQSKTIEVLKRLMGFLEDGERFGITLDQSVINKIQS
FT                   AINTVETDILKVALIGGFSEGKTSIAAAWSEKYDTSSMIISQSESTDNVNIYKLDDFEL
FT                   IDTPGLFGFKETEDRQRFNDLTKKYVSEANLIIYVMNPNNPIKESHKEDLTWLFKDLNL
FT                   LPRTVFVISRFDEEADLEDEDDFNERFYTKRENILSRLNDFGIIQKNEEISVVAVSANP
FT                   FGEGIDHWLSNLNEYKKISRISQLQEATTEKIKSVGGEHSFVVETQMSILRDVIKREMP
FT                   TAMERVVQASKEVEKLRNTFIDIQKELNKSEKKISDARIDLRTNISSHFKDLILQVKGT
FT                   DLNTIDDFFERNIGDEGIVLETDIQNEFDRQLGKITHEISQAEKSLKSSVGHYNNIVGD
FT                   MALDGMKLGGEFLKKGGFQLNKEAVLATRDLLAPSIKFKPWGAFKLAKNLNKGAAVFGA
FT                   VLGLGLEVWESWSKRKKEQEFQKLIEKTVQHLSDQRKEYLAFVNNDEFEHTFFPQYIQL
FT                   LNDIEQIKTEVSNRETIQKEFEKWQHQGEIIEAEYKLLP"
     METIDYFKQR QSKTIEVLKR LMGFLEDGER FGITLDQSVI NKIQSAINTV ETDILKVALI        60
     GGFSEGKTSI AAAWSEKYDT SSMIISQSES TDNVNIYKLD DFELIDTPGL FGFKETEDRQ       120
     RFNDLTKKYV SEANLIIYVM NPNNPIKESH KEDLTWLFKD LNLLPRTVFV ISRFDEEADL       180
     EDEDDFNERF YTKRENILSR LNDFGIIQKN EEISVVAVSA NPFGEGIDHW LSNLNEYKKI       240
     SRISQLQEAT TEKIKSVGGE HSFVVETQMS ILRDVIKREM PTAMERVVQA SKEVEKLRNT       300
     FIDIQKELNK SEKKISDARI DLRTNISSHF KDLILQVKGT DLNTIDDFFE RNIGDEGIVL       360
     ETDIQNEFDR QLGKITHEIS QAEKSLKSSV GHYNNIVGDM ALDGMKLGGE FLKKGGFQLN       420
     KEAVLATRDL LAPSIKFKPW GAFKLAKNLN KGAAVFGAVL GLGLEVWESW SKRKKEQEFQ       480
     KLIEKTVQHL SDQRKEYLAF VNNDEFEHTF FPQYIQLLND IEQIKTEVSN RETIQKEFEK       540
     WQHQGEIIEA EYKLLP                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page