(data stored in ACNUC7421 zone)

EMBL: CP001791.PE207

CP001791.PE207       Location/Qualifiers
FT   CDS             230222..230680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97759"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97759.1"
FT                   /translation="MKDFFNSAKGKWDQVKASTYRLKLDGDKLMRLAINTVPADKNIVI
FT                   ESIDVVSGTIVVTGKTMKYKINHNFSLTVVPDGFNDREISFKLITMKPFNNEWLKSQVF
FT                   TDVSPYVHYDNSRFTLELNKIANVEKSPFGKIKESTIAEDKYVIGFGV"
     MKDFFNSAKG KWDQVKASTY RLKLDGDKLM RLAINTVPAD KNIVIESIDV VSGTIVVTGK        60
     TMKYKINHNF SLTVVPDGFN DREISFKLIT MKPFNNEWLK SQVFTDVSPY VHYDNSRFTL       120
     ELNKIANVEK SPFGKIKEST IAEDKYVIGF GV                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page