(data stored in ACNUC7421 zone)

EMBL: CP001791.PE209

CP001791.PE209       Location/Qualifiers
FT   CDS             complement(232388..232945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0215"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: mxa:MXAN_4309 ECF subfamily RNA polymerase
FT                   sigma factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: sigma-70 region 2 domain protein;
FT                   Sigma-70 region 4 type 2; sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97761"
FT                   /db_xref="GOA:D6XVY8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH97761.1"
FT                   /translation="MTDEELIQEILDGNDEAMKELHGRHVQSVFQYLYIQMSDYHDAQE
FT                   LLQDVMYKAARRLATFKGDSAFKTWLFAIAKHAVIDYYRTRGKRRRTTAVDNTVMDAVG
FT                   DLKESAEQTVIRQMETESVMQTIRQLPQTYRDVLHLRFIEGFSIKETAKVMGKTSMSVK
FT                   ALQKRARAELVNRIGNEVTAYE"
     MTDEELIQEI LDGNDEAMKE LHGRHVQSVF QYLYIQMSDY HDAQELLQDV MYKAARRLAT        60
     FKGDSAFKTW LFAIAKHAVI DYYRTRGKRR RTTAVDNTVM DAVGDLKESA EQTVIRQMET       120
     ESVMQTIRQL PQTYRDVLHL RFIEGFSIKE TAKVMGKTSM SVKALQKRAR AELVNRIGNE       180
     VTAYE                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page