(data stored in ACNUC7421 zone)

EMBL: CP001791.PE21

CP001791.PE21        Location/Qualifiers
FT   CDS             31230..31382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97573"
FT                   /db_xref="InterPro:IPR025550"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97573.1"
FT                   /translation="MRPNQISLETAQMLSEKLNMPLEHVMHTPPHILMAKLKEIEDQQE
FT                   ADKKD"
     MRPNQISLET AQMLSEKLNM PLEHVMHTPP HILMAKLKEI EDQQEADKKD                   50
//

If you have problems or comments...

PBIL Back to PBIL home page