(data stored in ACNUC7421 zone)

EMBL: CP001791.PE210

CP001791.PE210       Location/Qualifiers
FT   CDS             complement(233078..233428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_1781 UspA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97762"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR038396"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97762.1"
FT                   /translation="MNIVPHYEDAILEVTVDGEFTDEEITRLEAHFKEMKAGHSQVKML
FT                   LVIDNIHVTLKGLIEDLKFDMKYWNDFDKIAVVSDKKSVEIVTRLSSVLPKLEMKHFTL
FT                   SKVTDATSWLKE"
     MNIVPHYEDA ILEVTVDGEF TDEEITRLEA HFKEMKAGHS QVKMLLVIDN IHVTLKGLIE        60
     DLKFDMKYWN DFDKIAVVSD KKSVEIVTRL SSVLPKLEMK HFTLSKVTDA TSWLKE           116
//

If you have problems or comments...

PBIL Back to PBIL home page