(data stored in ACNUC7421 zone)

EMBL: CP001791.PE213

CP001791.PE213       Location/Qualifiers
FT   CDS             234645..235481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0219"
FT                   /product="Nucleotide binding protein PINc"
FT                   /note="SMART: Nucleotide binding protein PINc; KEGG:
FT                   aha:AHA_0872 PhoH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97765"
FT                   /db_xref="GOA:D6XVZ2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ2"
FT                   /inference="protein motif:SMART:SM00670"
FT                   /protein_id="ADH97765.1"
FT                   /translation="MGIMYLIQDLQEQIVFYVLVLLLMQAAGVYYLLKIHSKIFKPKPN
FT                   GLKAVLFGLLGKGLGQAYNGQLTKAILFISIYPLLLIVGFFSQELFAETNLLAYTFFGG
FT                   YTLSLIDAGRSAKYGKMRFLKLKRQEDVKAKINQLLTYYQSEYKLAVDTNILMHEADLL
FT                   VNLLEQQKKEIHMSKIVFEELDGLKKSHHDTTRKKAQLAFDVIEEYQRRGLLKIMKGAK
FT                   SDEIRKYGLGHSSDERIIGTYLLAQNELESKFVFFSNDKGARIMARDAGLPVVEIS"
     MGIMYLIQDL QEQIVFYVLV LLLMQAAGVY YLLKIHSKIF KPKPNGLKAV LFGLLGKGLG        60
     QAYNGQLTKA ILFISIYPLL LIVGFFSQEL FAETNLLAYT FFGGYTLSLI DAGRSAKYGK       120
     MRFLKLKRQE DVKAKINQLL TYYQSEYKLA VDTNILMHEA DLLVNLLEQQ KKEIHMSKIV       180
     FEELDGLKKS HHDTTRKKAQ LAFDVIEEYQ RRGLLKIMKG AKSDEIRKYG LGHSSDERII       240
     GTYLLAQNEL ESKFVFFSND KGARIMARDA GLPVVEIS                               278
//

If you have problems or comments...

PBIL Back to PBIL home page