(data stored in ACNUC7421 zone)

EMBL: CP001791.PE215

CP001791.PE215       Location/Qualifiers
FT   CDS             complement(236969..238429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0222"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: sat:SYN_02721 HD domain/HAMP domain-containing
FT                   protein; PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; histidine kinase HAMP region domain protein; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97767"
FT                   /db_xref="GOA:D6XVZ4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ4"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADH97767.1"
FT                   /translation="MDLLNQFHVRMLINYMVGSLIAVFGVGSVFIFHTLTLSSEETLIL
FT                   LGIMVLSGLIMISLELFVYSKHIRPLVHFFKKGMNPQDAYMTAHSFPFMTVRRIMGPHL
FT                   LGLSIPATVMTLFALSLGFLTLPHLYVLYAWIGAILIATLHAMIEFFMTSRAVQPLIAS
FT                   ICARTDENLKLDGVKVISMKWKLLLSMLLIAVFPAALFLLAGQIRESAETTTAYWNWAF
FT                   LVIVVILFVSIAGAVVLYRNMEQPILELRKNLEQVQHGEFHEMPNYYADEFSTLINGFN
FT                   SMVSGIKSRDAENERLLESFFSVFAATLDARDSYTAGHTTRVADYSTQIARRSGLSGDE
FT                   LDLLRKSALLHDIGKIGIPDSVLLKDGKLTDEEFDKIKEHPVIGGDILEKVNLPEHLRP
FT                   LLDGVRHHHERFDGKGYPDGLSGDRIPLYGRIIAVADAFDAMTSNRPYRKAMSYEQARN
FT                   ILQNGRGSQWDPAFIDHFMDFYEERFKT"
     MDLLNQFHVR MLINYMVGSL IAVFGVGSVF IFHTLTLSSE ETLILLGIMV LSGLIMISLE        60
     LFVYSKHIRP LVHFFKKGMN PQDAYMTAHS FPFMTVRRIM GPHLLGLSIP ATVMTLFALS       120
     LGFLTLPHLY VLYAWIGAIL IATLHAMIEF FMTSRAVQPL IASICARTDE NLKLDGVKVI       180
     SMKWKLLLSM LLIAVFPAAL FLLAGQIRES AETTTAYWNW AFLVIVVILF VSIAGAVVLY       240
     RNMEQPILEL RKNLEQVQHG EFHEMPNYYA DEFSTLINGF NSMVSGIKSR DAENERLLES       300
     FFSVFAATLD ARDSYTAGHT TRVADYSTQI ARRSGLSGDE LDLLRKSALL HDIGKIGIPD       360
     SVLLKDGKLT DEEFDKIKEH PVIGGDILEK VNLPEHLRPL LDGVRHHHER FDGKGYPDGL       420
     SGDRIPLYGR IIAVADAFDA MTSNRPYRKA MSYEQARNIL QNGRGSQWDP AFIDHFMDFY       480
     EERFKT                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page