(data stored in ACNUC7421 zone)

EMBL: CP001791.PE217

CP001791.PE217       Location/Qualifiers
FT   CDS             complement(239117..239515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97769"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97769.1"
FT                   /translation="MGIYLTEEEDQCVHHGIILDLLKALIEKDQKSFQDRVWAEEMEMV
FT                   FVALNGVVAKKMRENNAQLRSLKVRYTFTGNESEQFANYMVYYRGYEEKKNYFIPHLND
FT                   LVNRTYRKLFTRYVMRPVEDQCQRQPSN"
     MGIYLTEEED QCVHHGIILD LLKALIEKDQ KSFQDRVWAE EMEMVFVALN GVVAKKMREN        60
     NAQLRSLKVR YTFTGNESEQ FANYMVYYRG YEEKKNYFIP HLNDLVNRTY RKLFTRYVMR       120
     PVEDQCQRQP SN                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page