(data stored in ACNUC7421 zone)

EMBL: CP001791.PE22

CP001791.PE22        Location/Qualifiers
FT   CDS             31959..33761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0023"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: AAA ATPase; TIGRFAM: DNA polymerase III,
FT                   subunits gamma and tau; KEGG: gbm:Gbem_0212 DNA polymerase
FT                   III, subunits gamma and tau; PFAM: AAA ATPase central
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97574"
FT                   /db_xref="GOA:D6XV16"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV16"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADH97574.1"
FT                   /translation="MAYQALYRVWRPQVLKDVVGQEHITRTLRNALLQQKLSHAYLFSG
FT                   PRGTGKTSAAKIIAKAVNCEQAPVEEPCNTCSTCTGIQDGSIVDVIEIDAASNNGVDEI
FT                   RDIRDKVKFAPSGASYKVYIIDEVHMLTTGAFNALLKTLEEPPRHVIFILATTEPHKIP
FT                   LTIISRCQRFDFKRITAHTMIKRMEEIIEDGDLAVDPDALSMIARASEGGMRDALSLLD
FT                   QAISYADTSVTLDDVLSIIGAASQDLMYDVMEALLDQQVADGLTAIDRLMSDGKDPGRF
FT                   MEDFIFLTRDLLMVQAAPALDESGDRKLGDQRFEILASKASQSWLFALMEKLNHFQQQM
FT                   KWASHPAVFLEMFVVQACQMPSREPEKAGLPEEVRQQISTLEHKLADLERRLQQAPSQA
FT                   PAGRPDQPASPSQPQAPVRKQPQAASTGASRANMQRVKGVLNEATKAHLKAIHQKWAQI
FT                   QDTVKQQNVAASAWLNDCKPVVASSGHYVLAFRNEMHRGMVDDKFRDLIEGVVSQVMDT
FT                   QLVMYTLLEQDWEEVKAAFVKEQKKKQASQPADGNQESEDVPQDGDSEAAGQAVEDEPE
FT                   EDQGEAVVDEAIKMFGSDLVRIEE"
     MAYQALYRVW RPQVLKDVVG QEHITRTLRN ALLQQKLSHA YLFSGPRGTG KTSAAKIIAK        60
     AVNCEQAPVE EPCNTCSTCT GIQDGSIVDV IEIDAASNNG VDEIRDIRDK VKFAPSGASY       120
     KVYIIDEVHM LTTGAFNALL KTLEEPPRHV IFILATTEPH KIPLTIISRC QRFDFKRITA       180
     HTMIKRMEEI IEDGDLAVDP DALSMIARAS EGGMRDALSL LDQAISYADT SVTLDDVLSI       240
     IGAASQDLMY DVMEALLDQQ VADGLTAIDR LMSDGKDPGR FMEDFIFLTR DLLMVQAAPA       300
     LDESGDRKLG DQRFEILASK ASQSWLFALM EKLNHFQQQM KWASHPAVFL EMFVVQACQM       360
     PSREPEKAGL PEEVRQQIST LEHKLADLER RLQQAPSQAP AGRPDQPASP SQPQAPVRKQ       420
     PQAASTGASR ANMQRVKGVL NEATKAHLKA IHQKWAQIQD TVKQQNVAAS AWLNDCKPVV       480
     ASSGHYVLAF RNEMHRGMVD DKFRDLIEGV VSQVMDTQLV MYTLLEQDWE EVKAAFVKEQ       540
     KKKQASQPAD GNQESEDVPQ DGDSEAAGQA VEDEPEEDQG EAVVDEAIKM FGSDLVRIEE       600
//

If you have problems or comments...

PBIL Back to PBIL home page