(data stored in ACNUC7421 zone)

EMBL: CP001791.PE227

CP001791.PE227       Location/Qualifiers
FT   CDS             245526..246134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_1413 general secretion pathway
FT                   protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97779"
FT                   /db_xref="GOA:D6XW06"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW06"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97779.1"
FT                   /translation="MMGLSRNDQRGLTLIELLAVIVIVGILAAIAVPAVNNVIENSRKD
FT                   AHLATAEAIYEASRLAVIDRQINAGDTDTTAYVFYTGTSSKLNEFLGGGENGIRRVNLV
FT                   EDGYLDSHPINPHTREPYQYTVLLRAGNQSYIQLTYGDGNTEKVFRLPEPSSALDVFIH
FT                   VPSETVRYRTATFRHHRAVSIDKLRREGRDNVKSGSEMR"
     MMGLSRNDQR GLTLIELLAV IVIVGILAAI AVPAVNNVIE NSRKDAHLAT AEAIYEASRL        60
     AVIDRQINAG DTDTTAYVFY TGTSSKLNEF LGGGENGIRR VNLVEDGYLD SHPINPHTRE       120
     PYQYTVLLRA GNQSYIQLTY GDGNTEKVFR LPEPSSALDV FIHVPSETVR YRTATFRHHR       180
     AVSIDKLRRE GRDNVKSGSE MR                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page