(data stored in ACNUC7421 zone)

EMBL: CP001791.PE228

CP001791.PE228       Location/Qualifiers
FT   CDS             246642..247127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0235"
FT                   /product="protein of unknown function DUF323"
FT                   /note="KEGG: dal:Dalk_0621 protein of unknown function
FT                   DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97780"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW07"
FT                   /inference="similar to AA sequence:KEGG:Dalk_0621"
FT                   /protein_id="ADH97780.1"
FT                   /translation="MKKMLATAAAILFVFAACSNDGTGTVEEDATNEAVVNDNQNHANA
FT                   NNDETDEEEEVPEAVDDELQAILDHFEGDGFDVGEQAFKAYEMVGAVDGFGVDVNGEEI
FT                   ELYLYDEGSEELEELRSEGQFDMDGFPIPGEVNGNIALMSHEEHPDQSEILSTFHDF"
     MKKMLATAAA ILFVFAACSN DGTGTVEEDA TNEAVVNDNQ NHANANNDET DEEEEVPEAV        60
     DDELQAILDH FEGDGFDVGE QAFKAYEMVG AVDGFGVDVN GEEIELYLYD EGSEELEELR       120
     SEGQFDMDGF PIPGEVNGNI ALMSHEEHPD QSEILSTFHD F                           161
//

If you have problems or comments...

PBIL Back to PBIL home page