(data stored in ACNUC7421 zone)

EMBL: CP001791.PE229

CP001791.PE229       Location/Qualifiers
FT   CDS             247859..248092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfl:PFL_0346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97781"
FT                   /db_xref="GOA:D6XW08"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97781.1"
FT                   /translation="MHVSLKSTNGVIKQSKVGFSWTVFFFAFFPPLFRCDIKWAAVIFV
FT                   SAILVGLASGGVLAWLPSVVLAFIITRQEDSI"
     MHVSLKSTNG VIKQSKVGFS WTVFFFAFFP PLFRCDIKWA AVIFVSAILV GLASGGVLAW        60
     LPSVVLAFII TRQEDSI                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page