(data stored in ACNUC7421 zone)

EMBL: CP001791.PE231

CP001791.PE231       Location/Qualifiers
FT   CDS             250060..250779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0239"
FT                   /product="protein of unknown function DUF1535"
FT                   /note="PFAM: protein of unknown function DUF1535; KEGG:
FT                   par:Psyc_0189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97783"
FT                   /db_xref="GOA:D6XW10"
FT                   /db_xref="InterPro:IPR011434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6XW10"
FT                   /inference="protein motif:PFAM:PF07553"
FT                   /protein_id="ADH97783.1"
FT                   /translation="MMKDCGFGFKQKGLAGLIVAFMMALIMTGCVNEASEATDGDVNDA
FT                   VNEEENAAEETVGEEPSENETAQEEEAPAEDDGTEEEEADPDVPREYLSALNKANDYLA
FT                   FSAMSESGLYNQLTSEYGEQFSAEAADYAMANIDVDWNEQALKSAESYNSYSPFSKKGL
FT                   FDQLTSEYGEGFTDEQAQYAIDNVDIDYKENALRSAESYQDLMDMSPSAIHDQLTSEYG
FT                   EGYTQEEADYALQNLSN"
     MMKDCGFGFK QKGLAGLIVA FMMALIMTGC VNEASEATDG DVNDAVNEEE NAAEETVGEE        60
     PSENETAQEE EAPAEDDGTE EEEADPDVPR EYLSALNKAN DYLAFSAMSE SGLYNQLTSE       120
     YGEQFSAEAA DYAMANIDVD WNEQALKSAE SYNSYSPFSK KGLFDQLTSE YGEGFTDEQA       180
     QYAIDNVDID YKENALRSAE SYQDLMDMSP SAIHDQLTSE YGEGYTQEEA DYALQNLSN        239
//

If you have problems or comments...

PBIL Back to PBIL home page