(data stored in ACNUC7421 zone)

EMBL: CP001791.PE233

CP001791.PE233       Location/Qualifiers
FT   CDS             252045..252467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0241"
FT                   /product="Protein of unknown function DUF2500"
FT                   /note="PFAM: Protein of unknown function DUF2500; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97785"
FT                   /db_xref="GOA:D6XWE3"
FT                   /db_xref="InterPro:IPR019635"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE3"
FT                   /inference="protein motif:PFAM:PF10694"
FT                   /protein_id="ADH97785.1"
FT                   /translation="MKMLSLSPAVFIPGATFNQFSAMPWFIQLVFLIVIGVLVFRAVRW
FT                   LAEWLSNNRQPVETTIAKVVSKREHQTRQSRGAGNQGIGLSRTRTRYFVTFEMETGERT
FT                   EFKVSGNEYGMLTEGDSGQLTHQGTRYHGFQRAGTT"
     MKMLSLSPAV FIPGATFNQF SAMPWFIQLV FLIVIGVLVF RAVRWLAEWL SNNRQPVETT        60
     IAKVVSKREH QTRQSRGAGN QGIGLSRTRT RYFVTFEMET GERTEFKVSG NEYGMLTEGD       120
     SGQLTHQGTR YHGFQRAGTT                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page