(data stored in ACNUC7421 zone)

EMBL: CP001791.PE234

CP001791.PE234       Location/Qualifiers
FT   CDS             252699..253574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97786"
FT                   /db_xref="GOA:D6XWE4"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97786.1"
FT                   /translation="MHLENERLKIEVQPPGTFYSGARFDWTGLISQVTLDGTVQYCVPE
FT                   RLEEGEGTGGHGFCNEFGLDQPVGYEETAPGQRFPKIGTGLLKKEADTAYDIFHPYEVV
FT                   PASMKVIKEDDAVIFEVSQESPGGYAYHLTKTVRLEGTRLIQAYTLLNTGQKPLQTNEY
FT                   SHNFIGMNDTLYNGSYELTIPGLESLDVVVGELSQQGETVTWPVTPTDDVYAGLTLGTG
FT                   VRDRTYHWDLYHRGLKAGVRDLSPFTPSKMALWGRAHVACPEVFIDLRIEPGERASWER
FT                   VYEFYREEAE"
     MHLENERLKI EVQPPGTFYS GARFDWTGLI SQVTLDGTVQ YCVPERLEEG EGTGGHGFCN        60
     EFGLDQPVGY EETAPGQRFP KIGTGLLKKE ADTAYDIFHP YEVVPASMKV IKEDDAVIFE       120
     VSQESPGGYA YHLTKTVRLE GTRLIQAYTL LNTGQKPLQT NEYSHNFIGM NDTLYNGSYE       180
     LTIPGLESLD VVVGELSQQG ETVTWPVTPT DDVYAGLTLG TGVRDRTYHW DLYHRGLKAG       240
     VRDLSPFTPS KMALWGRAHV ACPEVFIDLR IEPGERASWE RVYEFYREEA E                291
//

If you have problems or comments...

PBIL Back to PBIL home page