(data stored in ACNUC7421 zone)

EMBL: CP001791.PE235

CP001791.PE235       Location/Qualifiers
FT   CDS             253729..254757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0243"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   scl:sce1111 lipoprotein releasing system transmembrane
FT                   protein LolC"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97787"
FT                   /db_xref="GOA:D6XWE5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE5"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADH97787.1"
FT                   /translation="MGLAFKEIKRSKMKFTILGSIIFLISFLTFIISGLANGLAYDNVS
FT                   LIKDLPDGTYYMTEEADGNAAMSEIGEDLEASVLADHDGAFTMATQNGALRDEDDVRHN
FT                   VVFASSSDEERFGALEEGDVLLDESMKEDVQAGDSLTVDQLDLTLTVAGFLDETKYNHA
FT                   AVAWVKRADYETITRSEAMQFLLIPGDDAPTISGLDRFTADEFLNAIPSYSAEQLSLTM
FT                   IVWFLVAISGLLFAIFFYMMNVQKIGLYGILKAIGVKTSTLFGMMWLQMLIITLLSLTA
FT                   AALLSQLFQFAVEGLPFLLAVDQILELSVIFLVIGFLGATASGIQIRYIQPLQAIQQGE
FT                   MA"
     MGLAFKEIKR SKMKFTILGS IIFLISFLTF IISGLANGLA YDNVSLIKDL PDGTYYMTEE        60
     ADGNAAMSEI GEDLEASVLA DHDGAFTMAT QNGALRDEDD VRHNVVFASS SDEERFGALE       120
     EGDVLLDESM KEDVQAGDSL TVDQLDLTLT VAGFLDETKY NHAAVAWVKR ADYETITRSE       180
     AMQFLLIPGD DAPTISGLDR FTADEFLNAI PSYSAEQLSL TMIVWFLVAI SGLLFAIFFY       240
     MMNVQKIGLY GILKAIGVKT STLFGMMWLQ MLIITLLSLT AAALLSQLFQ FAVEGLPFLL       300
     AVDQILELSV IFLVIGFLGA TASGIQIRYI QPLQAIQQGE MA                          342
//

If you have problems or comments...

PBIL Back to PBIL home page