(data stored in ACNUC7421 zone)

EMBL: CP001791.PE236

CP001791.PE236       Location/Qualifiers
FT   CDS             254757..255428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0244"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: prw:PsycPRwf_0086 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97788"
FT                   /db_xref="GOA:D6XWE6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97788.1"
FT                   /translation="MAMFTMEGITKEIQNGEVQESLLKGVSLTLKEGEVTALTGASGSG
FT                   KSTLLTIAAGLQPASEGTIHFNGERVSTMSQEELRALRASSFGFVFQSAHLVPFLNVAD
FT                   QLALMLKVSGTKMKRIERDDRVEELLKAVGMTHRKKAYPASLSGGEKQRVAIARAVIHQ
FT                   PKVLFADEPTASLDSVKSNEVMTLIRNLTKDGQITTLMVTHDQEMLSYADRIVTMKDGI
FT                   I"
     MAMFTMEGIT KEIQNGEVQE SLLKGVSLTL KEGEVTALTG ASGSGKSTLL TIAAGLQPAS        60
     EGTIHFNGER VSTMSQEELR ALRASSFGFV FQSAHLVPFL NVADQLALML KVSGTKMKRI       120
     ERDDRVEELL KAVGMTHRKK AYPASLSGGE KQRVAIARAV IHQPKVLFAD EPTASLDSVK       180
     SNEVMTLIRN LTKDGQITTL MVTHDQEMLS YADRIVTMKD GII                         223
//

If you have problems or comments...

PBIL Back to PBIL home page