(data stored in ACNUC7421 zone)

EMBL: CP001791.PE237

CP001791.PE237       Location/Qualifiers
FT   CDS             255585..257015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0245"
FT                   /product="sodium/glutamate symporter"
FT                   /note="PFAM: sodium/glutamate symporter; KEGG:
FT                   dal:Dalk_2099 sodium/glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97789"
FT                   /db_xref="GOA:D6XWE7"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWE7"
FT                   /inference="protein motif:PFAM:PF03616"
FT                   /protein_id="ADH97789.1"
FT                   /translation="MELDVVSGVMRAIFFTFILISVFLLIGAYLRAKVKIIQNLFLPAS
FT                   VVGGLLGLILGPIVLRDYAVLPIPDDWLMIASLLPGLLIVPVVASVPLGLKMKQTKSSE
FT                   EGGSGSNGSRAIVIMFLILGIIAYAQTFYSLSVASVFKNVFSMEGIYPTFGTELSAGFT
FT                   GGHGTAGVIGSLLQSMDQPYWNTAQGVTTTVATVGIISGILIGILFINIAVRKGFTTFV
FT                   QSGSDMQGGIRTGLNADEASQESAGHETTNSSSIDSMGFHLALILMVSGLAFGIRYVFD
FT                   VNNVLILNMIPEWAYAILLMYGVWGIMIKMKLDWIVDVKTKTKIASTFTEYAVVAAIIS
FT                   LPIQAVFALILPLSIILIGGLAITVLLAYFLSKRYFKEYWFEKSMAILGTNTGVFLTGL
FT                   LLLKMVDPDLKSPVLRDYSISYSLNSLIGFVLFPLAFGFLIAYGYTSAILLYGSLGMLF
FT                   VIGLIIVGKKDKQEVQSI"
     MELDVVSGVM RAIFFTFILI SVFLLIGAYL RAKVKIIQNL FLPASVVGGL LGLILGPIVL        60
     RDYAVLPIPD DWLMIASLLP GLLIVPVVAS VPLGLKMKQT KSSEEGGSGS NGSRAIVIMF       120
     LILGIIAYAQ TFYSLSVASV FKNVFSMEGI YPTFGTELSA GFTGGHGTAG VIGSLLQSMD       180
     QPYWNTAQGV TTTVATVGII SGILIGILFI NIAVRKGFTT FVQSGSDMQG GIRTGLNADE       240
     ASQESAGHET TNSSSIDSMG FHLALILMVS GLAFGIRYVF DVNNVLILNM IPEWAYAILL       300
     MYGVWGIMIK MKLDWIVDVK TKTKIASTFT EYAVVAAIIS LPIQAVFALI LPLSIILIGG       360
     LAITVLLAYF LSKRYFKEYW FEKSMAILGT NTGVFLTGLL LLKMVDPDLK SPVLRDYSIS       420
     YSLNSLIGFV LFPLAFGFLI AYGYTSAILL YGSLGMLFVI GLIIVGKKDK QEVQSI           476
//

If you have problems or comments...

PBIL Back to PBIL home page