(data stored in ACNUC7421 zone)

EMBL: CP001791.PE24

CP001791.PE24        Location/Qualifiers
FT   CDS             34207..34803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0025"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: Zinc
FT                   finger C4-type, RecR; TOPRIM domain protein; KEGG:
FT                   ade:Adeh_3635 recombination protein RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97576"
FT                   /db_xref="GOA:D6XV18"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV18"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADH97576.1"
FT                   /translation="MQYPQPVTKLIEGFMKLPGIGPKTAARLAFYVLDMNEDDVLDFAK
FT                   ALVNAKRELTYCSVCHHITDTDPCRICDDQSRDRSIICVVQDAKDVIAMEKMREYTGMY
FT                   HVLHGAISPVDGIGPEDIFIPDLLKRLQDETVQELIIATNPNIEGEATAMYISRLVKPT
FT                   GMKVTRIAHGLPVGGDLEYADEMTLSRAIEGRREL"
     MQYPQPVTKL IEGFMKLPGI GPKTAARLAF YVLDMNEDDV LDFAKALVNA KRELTYCSVC        60
     HHITDTDPCR ICDDQSRDRS IICVVQDAKD VIAMEKMREY TGMYHVLHGA ISPVDGIGPE       120
     DIFIPDLLKR LQDETVQELI IATNPNIEGE ATAMYISRLV KPTGMKVTRI AHGLPVGGDL       180
     EYADEMTLSR AIEGRREL                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page