(data stored in ACNUC7421 zone)

EMBL: CP001791.PE240

CP001791.PE240       Location/Qualifiers
FT   CDS             259855..260313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0248"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   rlt:Rleg2_0700 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97792"
FT                   /db_xref="GOA:D6XWF0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF0"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADH97792.1"
FT                   /translation="MEKTEAYFMKQAIDLAKRAREEGNEPFGAILVKDGEVVMRGANHI
FT                   HSGSDPTFHAELGLIRAYCSAYQVSDLSEYTLYTSCEPCVMCSGAMVWANLGKVVYSVS
FT                   HDQLAEIAGGNIMIACRDVFQKSPNRPEVEGPICPEEGLQVFEGYRFG"
     MEKTEAYFMK QAIDLAKRAR EEGNEPFGAI LVKDGEVVMR GANHIHSGSD PTFHAELGLI        60
     RAYCSAYQVS DLSEYTLYTS CEPCVMCSGA MVWANLGKVV YSVSHDQLAE IAGGNIMIAC       120
     RDVFQKSPNR PEVEGPICPE EGLQVFEGYR FG                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page