(data stored in ACNUC7421 zone)

EMBL: CP001791.PE241

CP001791.PE241       Location/Qualifiers
FT   CDS             260582..261214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0249"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: bte:BTH_I2733 helix-turn-helix
FT                   domain-containing protein; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97793"
FT                   /db_xref="GOA:D6XWF1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADH97793.1"
FT                   /translation="MALGTTISQRRKELNLSQAFVAEEMGVSRQAVSKWETGQSVPSTA
FT                   HLIRLAEVLGCDVQDLAEPDQEAQPAQPAEESGSKKDIRMQLAAVFGRVLMLVGFLGYM
FT                   GAVSDPGDHGSMPLWFFNSWWLGHFAVGAGLTVIGTRDYYYRKGGPKSVIGWDLLFVGA
FT                   FLFYGFSPFGEGVTTLVTMVMGATALIMMNIRYFIPVWRRDRAPSGS"
     MALGTTISQR RKELNLSQAF VAEEMGVSRQ AVSKWETGQS VPSTAHLIRL AEVLGCDVQD        60
     LAEPDQEAQP AQPAEESGSK KDIRMQLAAV FGRVLMLVGF LGYMGAVSDP GDHGSMPLWF       120
     FNSWWLGHFA VGAGLTVIGT RDYYYRKGGP KSVIGWDLLF VGAFLFYGFS PFGEGVTTLV       180
     TMVMGATALI MMNIRYFIPV WRRDRAPSGS                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page