(data stored in ACNUC7421 zone)

EMBL: CP001791.PE243

CP001791.PE243       Location/Qualifiers
FT   CDS             261721..262044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97795"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97795.1"
FT                   /translation="MGFDLFSKAVNSAAEAVSSEVTLMNILIHFTPVKTYVYVADYYCF
FT                   DSDDGGVEFKNSDGSVEYTVSGNYVSLLIDQKDLTKEEKIRKAIRQYGLTEDGVAVIDC
FT                   CTS"
     MGFDLFSKAV NSAAEAVSSE VTLMNILIHF TPVKTYVYVA DYYCFDSDDG GVEFKNSDGS        60
     VEYTVSGNYV SLLIDQKDLT KEEKIRKAIR QYGLTEDGVA VIDCCTS                     107
//

If you have problems or comments...

PBIL Back to PBIL home page