(data stored in ACNUC7421 zone)

EMBL: CP001791.PE245

CP001791.PE245       Location/Qualifiers
FT   CDS             263648..264430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0253"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: vha:VIBHAR_01199
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97797"
FT                   /db_xref="GOA:D6XWF5"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="InterPro:IPR014564"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF5"
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /protein_id="ADH97797.1"
FT                   /translation="MNTVLVLAILLFILMRAVGGRKGAKSFVALFMNFVVLVVTVLFMS
FT                   HSTFDLLVLTVLACTAISWINLFFVNGVSHKTMTAFLSTWVTIILMIPLILFVTRRAMI
FT                   QGFPEEEMHELNVFSFYVGIDFIEVATAVILMSTIGAIIDIAISISSPMNEIIRQEPSI
FT                   SRKRLFEAGMGIGRDILGTSVNTLLFAFLGSYMALLIWFLDLNYTFGEMVNAKVFSAET
FT                   ITILSAGIGLTVVIPITCAITAVFLDRARNKDGTGMED"
     MNTVLVLAIL LFILMRAVGG RKGAKSFVAL FMNFVVLVVT VLFMSHSTFD LLVLTVLACT        60
     AISWINLFFV NGVSHKTMTA FLSTWVTIIL MIPLILFVTR RAMIQGFPEE EMHELNVFSF       120
     YVGIDFIEVA TAVILMSTIG AIIDIAISIS SPMNEIIRQE PSISRKRLFE AGMGIGRDIL       180
     GTSVNTLLFA FLGSYMALLI WFLDLNYTFG EMVNAKVFSA ETITILSAGI GLTVVIPITC       240
     AITAVFLDRA RNKDGTGMED                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page