(data stored in ACNUC7421 zone)

EMBL: CP001791.PE247

CP001791.PE247       Location/Qualifiers
FT   CDS             266165..269509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0255"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97799"
FT                   /db_xref="GOA:D6XWF7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF7"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ADH97799.1"
FT                   /translation="MKKWIESTSLKEWLIYLLPVIWLVLLAVSFVTAPDIDQFVREEGQ
FT                   AEAPEGFPSQIAEELIEEDDGFGGEEILLVYEQEDGFSSEQKEEIKEVLAGLSEEDHNL
FT                   PIHAVTGPFDGDMEEERLISEDGDVLIALVEMDIEAHEYADIRNELQEASQAEGVDHDQ
FT                   TGEAVINEDVVVSTEEGLVTSTYITVSLVFLVLALVFKSLVSPLVPLLLLGTVYLFSIS
FT                   IVSRLIDWVGFPVSNFTQMFVLAVVFGVGTDYCILIMKRFQEEVLKDQTAFQAMLTTMR
FT                   ASKSTVLYSALTGFIGFATIYLADFDLYQSAVGVAVAVLVMMAGIWMVMPAVLALGGVR
FT                   LFWPGKPGSSNPSNPLWGFIGGLTLRSPKLALVAVALLVIPFYLFYDDLRSFDNVQEIR
FT                   GDYDSVKAYELTEEAFGQGDLFFSTLYLKTDEASWDDHGKIAHLEQLAMNIEKVEGIRG
FT                   VRGLNRPDEDVPDEFRIPEQAGILSEGMVEALDGLDELSDGIHEMKDGLDDSEELLDEA
FT                   EAGIGELIAGTEEIMAAVEEAEDQLDEAEAGIRNLMEGTEELGSGAKEIGEGIGEIRQG
FT                   LEDAGRDVSSSREDLGLWQTRAEAVVSEIEAFERRGSELENEVQERAETVNNRYQAARR
FT                   EAEEALANAAEEKEQLRSELQEALNDLEAEAEGDLPSEELGRIRSLLDGHSVVPEDVTL
FT                   PDLDLTALVPDLPIPPFSSYADEIRSALEDGDGQLQELEEGLTEAAEGLEEAEEGAGDL
FT                   QVGLDDVQDGHQELLDGMAEARQGASDLSGGLDELQSGHYALLDGVGEGRNGLENFRKG
FT                   LRDMLEGTEELNEGIGEAEDALRQVSKQEENPLEGLFIPNEAFEEEAFEEAFDQYVTPG
FT                   GQVAGMELLFEEDPYSQEAMMILDEVEEVAAFTLRDTPFEDKEMAFSGITSSNRDLRDV
FT                   SDQDFFVTAAVMLAGIFIALTFLFKSLIMPLYVLVSLVLTYIGSMAVAELIFVTILGYD
FT                   GIMWAVPFFSFVLLMALGVDYSIFLMGRFREILEEGEEITIHDAIHIAMKRIGGTVISA
FT                   ALILGGTFAAMMASGVLTLMQVSTVIMTGLLLYTLVMLPVFVPACMLLLGSWNWWPLGR
FT                   PKSERDS"
     MKKWIESTSL KEWLIYLLPV IWLVLLAVSF VTAPDIDQFV REEGQAEAPE GFPSQIAEEL        60
     IEEDDGFGGE EILLVYEQED GFSSEQKEEI KEVLAGLSEE DHNLPIHAVT GPFDGDMEEE       120
     RLISEDGDVL IALVEMDIEA HEYADIRNEL QEASQAEGVD HDQTGEAVIN EDVVVSTEEG       180
     LVTSTYITVS LVFLVLALVF KSLVSPLVPL LLLGTVYLFS ISIVSRLIDW VGFPVSNFTQ       240
     MFVLAVVFGV GTDYCILIMK RFQEEVLKDQ TAFQAMLTTM RASKSTVLYS ALTGFIGFAT       300
     IYLADFDLYQ SAVGVAVAVL VMMAGIWMVM PAVLALGGVR LFWPGKPGSS NPSNPLWGFI       360
     GGLTLRSPKL ALVAVALLVI PFYLFYDDLR SFDNVQEIRG DYDSVKAYEL TEEAFGQGDL       420
     FFSTLYLKTD EASWDDHGKI AHLEQLAMNI EKVEGIRGVR GLNRPDEDVP DEFRIPEQAG       480
     ILSEGMVEAL DGLDELSDGI HEMKDGLDDS EELLDEAEAG IGELIAGTEE IMAAVEEAED       540
     QLDEAEAGIR NLMEGTEELG SGAKEIGEGI GEIRQGLEDA GRDVSSSRED LGLWQTRAEA       600
     VVSEIEAFER RGSELENEVQ ERAETVNNRY QAARREAEEA LANAAEEKEQ LRSELQEALN       660
     DLEAEAEGDL PSEELGRIRS LLDGHSVVPE DVTLPDLDLT ALVPDLPIPP FSSYADEIRS       720
     ALEDGDGQLQ ELEEGLTEAA EGLEEAEEGA GDLQVGLDDV QDGHQELLDG MAEARQGASD       780
     LSGGLDELQS GHYALLDGVG EGRNGLENFR KGLRDMLEGT EELNEGIGEA EDALRQVSKQ       840
     EENPLEGLFI PNEAFEEEAF EEAFDQYVTP GGQVAGMELL FEEDPYSQEA MMILDEVEEV       900
     AAFTLRDTPF EDKEMAFSGI TSSNRDLRDV SDQDFFVTAA VMLAGIFIAL TFLFKSLIMP       960
     LYVLVSLVLT YIGSMAVAEL IFVTILGYDG IMWAVPFFSF VLLMALGVDY SIFLMGRFRE      1020
     ILEEGEEITI HDAIHIAMKR IGGTVISAAL ILGGTFAAMM ASGVLTLMQV STVIMTGLLL      1080
     YTLVMLPVFV PACMLLLGSW NWWPLGRPKS ERDS                                  1114
//

If you have problems or comments...

PBIL Back to PBIL home page