(data stored in ACNUC7421 zone)

EMBL: CP001791.PE248

CP001791.PE248       Location/Qualifiers
FT   CDS             complement(269555..270514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0256"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   vap:Vapar_6338 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97800"
FT                   /db_xref="GOA:D6XWF8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWF8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADH97800.1"
FT                   /translation="MKRFVKWTLIALPIVLIAIAGIIIGGSYLEHQNAIEEDMAYYPAP
FT                   GERIDIHGDGHAMHVHGEGKGGATVVFLAGFGTPSPFYDFQAIRRALPDGYRTVVVERF
FT                   GYGWSDVTDYDRDIGTVTDETRAALKEAGEEGPFILAGHSMAGIEALHYAQAYPEEVTA
FT                   IIGLDPLVPAYYDEHGEEPEVSGVVTFLARSGLMRQQPDVFNENFHAMAKGLLDDDDAE
FT                   AARSVFNRRVQTANMADEAEKLTANVRTVQDAGTPDAPFFAAISSENHDGQPFIEALAA
FT                   DTGGKSRIFDGGHYIHLDQPEAIAKQIVDWMQAEAGSD"
     MKRFVKWTLI ALPIVLIAIA GIIIGGSYLE HQNAIEEDMA YYPAPGERID IHGDGHAMHV        60
     HGEGKGGATV VFLAGFGTPS PFYDFQAIRR ALPDGYRTVV VERFGYGWSD VTDYDRDIGT       120
     VTDETRAALK EAGEEGPFIL AGHSMAGIEA LHYAQAYPEE VTAIIGLDPL VPAYYDEHGE       180
     EPEVSGVVTF LARSGLMRQQ PDVFNENFHA MAKGLLDDDD AEAARSVFNR RVQTANMADE       240
     AEKLTANVRT VQDAGTPDAP FFAAISSENH DGQPFIEALA ADTGGKSRIF DGGHYIHLDQ       300
     PEAIAKQIVD WMQAEAGSD                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page