(data stored in ACNUC7421 zone)

EMBL: CP001791.PE250

CP001791.PE250       Location/Qualifiers
FT   CDS             complement(272412..272630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97802"
FT                   /db_xref="GOA:D6XWG0"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97802.1"
FT                   /translation="MYLLIPLGFIAVSFIILIARRKSMQEDLAFVKAHPNSQEAAIRQK
FT                   AMIRWIWGVTIWGVVSMTLVVWLFQTF"
     MYLLIPLGFI AVSFIILIAR RKSMQEDLAF VKAHPNSQEA AIRQKAMIRW IWGVTIWGVV        60
     SMTLVVWLFQ TF                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page