(data stored in ACNUC7421 zone)

EMBL: CP001791.PE252

CP001791.PE252       Location/Qualifiers
FT   CDS             273219..274169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP0608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97804"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97804.1"
FT                   /translation="MTGKRIHLDQAKRWLVRNGRPLEVMRFRYWFEEGSTEDVMDVLTG
FT                   YQNEDGGFGHGIEPDFTCPMSSAIGSWTAARMLFELKTPAAHPVIRKLMDYLIATQNRA
FT                   TGMWQTTFPEISHFPHAPWWSWHEQAQEEWQFNPGVELAAYCLYYGGGDEAATEAGLLT
FT                   MRKALKRLMTVNDMDHHELSNFQYALHILQDQFDAVEADTGFSLRRCEDQLHSLLYQAV
FT                   ETDPLKWGRGYQALPLDVVHSWKDVRNIGFEDGLVEKQIQYWKTTRERDGAWPISWEWG
FT                   QYPEAFAIAKRQWQGILIVERFKKLKQLGMIQEET"
     MTGKRIHLDQ AKRWLVRNGR PLEVMRFRYW FEEGSTEDVM DVLTGYQNED GGFGHGIEPD        60
     FTCPMSSAIG SWTAARMLFE LKTPAAHPVI RKLMDYLIAT QNRATGMWQT TFPEISHFPH       120
     APWWSWHEQA QEEWQFNPGV ELAAYCLYYG GGDEAATEAG LLTMRKALKR LMTVNDMDHH       180
     ELSNFQYALH ILQDQFDAVE ADTGFSLRRC EDQLHSLLYQ AVETDPLKWG RGYQALPLDV       240
     VHSWKDVRNI GFEDGLVEKQ IQYWKTTRER DGAWPISWEW GQYPEAFAIA KRQWQGILIV       300
     ERFKKLKQLG MIQEET                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page